PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100147450021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family Dof
Protein Properties Length: 233aa    MW: 26107.6 Da    PI: 8.7938
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100147450021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof75.76e-2462992663
                        zf-Dof 26 lsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                                  lsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Ote100147450021|100147450021 62 LSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 99
                                  79********************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-102686IPR003851Zinc finger, Dof-type
PROSITE profilePS5088417.4394296IPR003851Zinc finger, Dof-type
PfamPF027013.0E-186296IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MDTAQWPQGI EFVKTGTEIS DSNSKPNAAV EKKPRPQKEQ ALXXXXXXXX XXXXXXXXXX  60
XLSQPRYFCK TCRRYWTEGG SLRNVPVGGG SRKNKRSSSA AVAAPAKKAL NDLSLPNFSP  120
QNPRIQQGHD LNLAYNPPSH YTAVSEFQNN LPLMELLKTG NMSSFMSAPI AAPDFKPGLE  180
YGXXXXXXXX EDQPSRINVF PFEGLKRVSN NEQFEEERET NGYWNGMLAG GCW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075948.12e-57PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLV7ASA72e-51V7ASA7_PHAVU; Uncharacterized protein
STRINGVIT_02s0025g02250.t011e-45(Vitis vinifera)
STRINGPOPTR_0015s01160.17e-46(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419